PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C003604P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family Trihelix
Protein Properties Length: 312aa    MW: 34899 Da    PI: 4.5414
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C003604P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix29.61.8e-0929106280
        trihelix   2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcp 80 
                     Wt    l+L+++   +e +  ++ +  ++W+ v++++ +  + r+++qC+ kw+ l  ++  ik++e k  +++ s ++
  MELO3C003604P1  29 WTAADCLVLVNVIAAVEADCLKALSSYQKWKIVAENCTSLDVVRTSNQCRRKWDCLLIEHDVIKQWELKM-PDDDSYWR 106
                     ******************************************************************9996.66666775 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.692985IPR017877Myb-like domain
PfamPF138371.0E-629100No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
Sequence ? help Back to Top
Protein Sequence    Length: 312 aa     Download sequence    Send to blast
MKKENAGNRG SGVSGSRRTR SQIAVAPGWT AADCLVLVNV IAAVEADCLK ALSSYQKWKI  60
VAENCTSLDV VRTSNQCRRK WDCLLIEHDV IKQWELKMPD DDSYWRLASG RRKELGLPEN  120
FDEELFKAID NVASMRANQS DTEPDSDPEA AIENANEIAE PGPKRQRRRS MSKSNQALEN  180
SPECERNQAL EISLECKEVE DGGEGEGEEV KEKPLLSSPE LESQEYYIKS NESKVADDVE  240
PKEQMMAKFL LENAEKVQAI VSENAEYTTS DEKCNKDQTN LVRHQGSKLI RCLGDILNTI  300
NDLRGLLKDC D*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818240.0LN681824.1 Cucumis melo genomic scaffold, anchoredscaffold01596.
GenBankLN7132580.0LN713258.1 Cucumis melo genomic chromosome, chr_4.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008466283.10.0PREDICTED: uncharacterized protein LOC103503736 isoform X1
RefseqXP_008466282.10.0PREDICTED: uncharacterized protein LOC103503736 isoform X1
RefseqXP_008466281.10.0PREDICTED: uncharacterized protein LOC103503736 isoform X1
TrEMBLA0A0A0LDW00.0A0A0A0LDW0_CUCSA; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF67322633
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.13e-47sequence-specific DNA binding transcription factors